Antibodies

View as table Download

Rabbit Polyclonal Anti-ALG6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALG6 antibody: synthetic peptide directed towards the N terminal of human ALG6. Synthetic peptide located within the following region: YEAQRHWQEITFNLPVKQWYFNSSDNNLQYWGLDYPPLTAYHSLLCAYVA

Rabbit Polyclonal Anti-ALG6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALG6 antibody: synthetic peptide directed towards the N terminal of human ALG6. Synthetic peptide located within the following region: PLTAYHSLLCAYVAKFINPDWIALHTSRGYESQAHKLFMRTTVLIADLLI

Rabbit Polyclonal Anti-ALG6 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ALG6