ALG6 Rabbit Polyclonal Antibody

CAT#: TA341916

Rabbit Polyclonal Anti-ALG6 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "ALG6"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ALG6 antibody: synthetic peptide directed towards the N terminal of human ALG6. Synthetic peptide located within the following region: PLTAYHSLLCAYVAKFINPDWIALHTSRGYESQAHKLFMRTTVLIADLLI
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 58 kDa
Gene Name ALG6, alpha-1,3-glucosyltransferase
Background This gene encodes a member ofThe ALG6/ALG8 glucosyltransferase family.The encoded protein catalyzesThe addition ofThe first glucose residue toThe growing lipid-linked oligosaccharide precursor of N-linked glycosylation. Mutations inThis gene are associated with congenital disorders of glycosylation type Ic. [provided by RefSeq, Jul 2008]
Synonyms CDG1C
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Horse: 93%; Bovine: 93%; Dog: 92%; Zebrafish: 77%
Reference Data
Protein Families Druggable Genome, Transmembrane
Protein Pathways Metabolic pathways, N-Glycan biosynthesis

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.