Rabbit Polyclonal Anti-ANKMY2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANKMY2 antibody: synthetic peptide directed towards the N terminal of human ANKMY2. Synthetic peptide located within the following region: DVVNSVGRTAAQMAAFVGQHDCVTIINNFFPRERLDYYTKPQGLDKEPKL |
Rabbit Polyclonal Anti-ANKMY2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANKMY2 antibody: synthetic peptide directed towards the N terminal of human ANKMY2. Synthetic peptide located within the following region: MVHIKKGELTQEEKELLEVIGKGTVQEAGTLLSSKNVRVNCLDENGMTPL |
Germany
Japan
United Kingdom
China
