ANKMY2 Rabbit Polyclonal Antibody

CAT#: TA344796

Rabbit Polyclonal Anti-ANKMY2 Antibody - N-terminal region

Product Images

WB Suggested Anti-ANKMY2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ANKMY2 antibody: synthetic peptide directed towards the N terminal of human ANKMY2. Synthetic peptide located within the following region: MVHIKKGELTQEEKELLEVIGKGTVQEAGTLLSSKNVRVNCLDENGMTPL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: ankyrin repeat and MYND domain containing 2
• Database Link:
  NP_064715
  Entrez Gene 57037 Human
  UniProt ID Q8IV38
• Background: The function of this protein remains unknown.
• Synonyms: ZMYND20
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 92%; Yeast: 90%; Guinea pig: 86%