ANKMY2 (NM_020319) Human Recombinant Protein

CAT#: TP306770

Recombinant protein of human ankyrin repeat and MYND domain containing 2 (ANKMY2)

Product Images

Coomassie blue staining of purified ANKMY2 protein (Cat# TP306770). The protein was produced from HEK293T cells transfected with ANKMY2 cDNA clone (Cat# RC206770) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206770 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVHIKKGELTQEEKELLEVIGKGTVQEAGTLLSSKNVRVNCLDENGMTPLMHAAYKGKLDMCKLLLRHGA
  DVNCHQHEHGYTALMFAALSGNKDITWVMLEAGAETDVVNSVGRTAAQMAAFVGQHDCVTIINNFFPRER
  LDYYTKPQGLDKEPKLPPKLAGPLHKIITTTNLHPVKIVMLVNENPLLTEEAALNKCYRVMDLICEKCMK
  QRDMNEVLAMKMHYISCIFQKCINFLKDGENKLDTLIKSLLKGRASDGFPVYQEKIIRESIRKFPYCEAT
  LLQQLVRSIAPVEIGSDPTAFSVLTQAITGQVGFVDVEFCTTCGEKGASKRCSVCKMVIYCDQTCQKTHW
  FTHKKICKNLKDIYEKQQLEAAKEKRQEENHGKLDVNSNCVNEEQPEAEVGISQKDSNPEDSGEGKKESL
  ESEAELEGLQDAPAGPQVSEE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 49.1 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_064715
• Locus ID: 57037
• UniProt ID: Q8IV38, A0A024R9Z6
• Cytogenetics: 7p21.1
• Refseq Size: 2567
• Refseq ORF: 1323
• Synonyms: ZMYND20
• Summary: May be involved in the trafficking of signaling proteins to the cilia.[UniProtKB/Swiss-Prot Function]