Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit anti-ARG1 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ARG1 |
Goat Anti-Arginase I Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Pig |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CFGLAREGNHKPID, from the C Terminus of the protein sequence according to NP_000036.2. |
Goat Polyclonal Antibody against Arg1 (C-terminal)
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NHKPETDYLKPPK, from the C Terminus of the protein sequence according to NP_058830.2. |
Rabbit polyclonal ARG1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ARG1. |
Rabbit Polyclonal Anti-ARG1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARG1 antibody: synthetic peptide directed towards the N terminal of human ARG1. Synthetic peptide located within the following region: HSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLK |
Rabbit Polyclonal Anti-ARG1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARG1 antibody: synthetic peptide directed towards the C terminal of human ARG1. Synthetic peptide located within the following region: LDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK |
Goat Polyclonal Antibody against ARG1
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-REGNHKPIDYLNPPK, from the C Terminus of the protein sequence according to NP_000036.2. |
Rabbit Polyclonal Anti-ARG1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARG1 antibody: synthetic peptide directed towards the N terminal of human ARG1. Synthetic peptide located within the following region: SAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYG |
Rabbit anti ARG1 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- ARG1
Clonalities
- Polyclonal
Conjugates
- Unconjugated