Antibodies

View as table Download

Rabbit polyclonal BCKD antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human BCKD.

Rabbit Polyclonal Anti-BCKD Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-BCKD Antibody: A synthesized peptide derived from human BCKD

Rabbit Polyclonal Antibody against BCKDK (Center)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This BCKDK antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 120-151 amino acids from the Central region of human BCKDK.

Rabbit Polyclonal Anti-BCKDK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BCKDK antibody: synthetic peptide directed towards the N terminal of human BCKDK. Synthetic peptide located within the following region: CLPFIIGCNPTILHVHELYIRAFQKLTDFPPIKDQADEAQYCQLVRQLLD

Bckdk Antibody - N-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated

BCKDK rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human BCKDK

BCKDK rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human BCKDK

BCKDK Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 153-412 of human BCKDK (NP_005872.2).
Modifications Unmodified