BCKDH kinase (BCKDK) Rabbit Polyclonal Antibody

CAT#: TA340087

Rabbit Polyclonal Anti-BCKDK Antibody

Product Images

WB Suggested Anti-BCKDK Antibody Titration: 0.2-1 ug/ml; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BCKDK antibody: synthetic peptide directed towards the N terminal of human BCKDK. Synthetic peptide located within the following region: CLPFIIGCNPTILHVHELYIRAFQKLTDFPPIKDQADEAQYCQLVRQLLD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: branched chain ketoacid dehydrogenase kinase
• Database Link:
  NP_005872
  Entrez Gene 10295 Human
  UniProt ID O14874
• Background: BCKDK belongs to the PDK/BCKDK protein kinase family. It contains 1 histidine kinase domain. BCKDK catalyzes the phosphorylation and inactivation of the branched-chain alpha-ketoacid dehydrogenase complex, the key regulatory enzyme of the valine, leucine and isoleucine catabolic pathways. BCKDK is the key enzyme that regulates the activity state of the BCKD complex.
• Synonyms: BCKDKD; BDK
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Guinea pig: 93%; Horse: 92%; Rabbit: 86%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase