Antibodies

View as table Download

CITED4 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CITED4

Rabbit Polyclonal Anti-Cited4 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Cited4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PPPPGTLAYGSFGSPVSFQPFPVSQSPGAGSTHLQSAATPSPGRIPAPPA

Rabbit Polyclonal Anti-CITED4 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CITED4 antibody: synthetic peptide directed towards the N terminal of mouse CITED4. Synthetic peptide located within the following region: PYAGPGMDSGLRPRGAPLGPPPPPGTLAYGSFGSPVSFQPFPVSQSPGAG