Antibodies

View as table Download

Goat Polyclonal Antibody against DBNL

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence AANLSRNGPALQE-C, from the N Terminus of the protein sequence according to NP_054782.2; NP_001014436.1.

Rabbit Polyclonal Anti-DBNL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DBNL antibody: synthetic peptide directed towards the middle region of human DBNL. Synthetic peptide located within the following region: QESAVHPREIFKQKERAMSTTSISSPQPGKLRSPFLQKQLTQPETHFGRE

DBNL Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 131-430 of human DBNL (NP_001014436.1).
Modifications Unmodified