Antibodies

View as table Download

Rabbit Polyclonal Anti-GNL3 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GNL3 antibody: synthetic peptide directed towards the middle region of human GNL3. Synthetic peptide located within the following region: RKQEEREDDKDSDQETVDEEVDENSSGMFAAEETGEALSEETTAGEQSTR

Rabbit Polyclonal Anti-GNL3 Antibody - N-terminal region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GNL3 antibody: synthetic peptide directed towards the N terminal of human GNL3. Synthetic peptide located within the following region: MTCHKRYKIQKKVREHHRKLRKEAKKRGHKKPRKDPGVPNSAPFKEALLR

Rabbit polyclonal Hsp22 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat. Not yet tested on other species
Conjugation Unconjugated
Immunogen Human Hsp22

Goat Anti-GNL3 (aa115-126) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TENKAKSGKQNS, from the internal region of the protein sequence according to NP_055181.3; NP_996561.1.

Rabbit Polyclonal Anti-GNL3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human GNL3

GNL3 rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human GNL3

GNL3 Rabbit polyclonal Antibody

Applications IF, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human GNL3 (NP_996562.1).
Modifications Unmodified