Rabbit Polyclonal Anti-PPM1J Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPM1J antibody: synthetic peptide directed towards the N terminal of human PPM1J. Synthetic peptide located within the following region: TFLQLSPGGLRRADDHAGRAVQSPPDTGRRLPWSTGYAEVINAGKSRHNE |
Rabbit Polyclonal Anti-PPM1J Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPM1J antibody: synthetic peptide directed towards the C terminal of human PPM1J. Synthetic peptide located within the following region: YTALAQALVLGARGTPRDRGWRLPNNKLGSGDDISVFVIPLGGPGSYS |
PPM1J Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 130-260 of human PPM1J (NP_005158.5). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China