PPM1J Rabbit Polyclonal Antibody

CAT#: TA335086

Rabbit Polyclonal Anti-PPM1J Antibody

Product Images

WB Suggested Anti-PPM1J Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: 721_B cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PPM1J antibody: synthetic peptide directed towards the C terminal of human PPM1J. Synthetic peptide located within the following region: YTALAQALVLGARGTPRDRGWRLPNNKLGSGDDISVFVIPLGGPGSYS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: protein phosphatase, Mg2+/Mn2+ dependent 1J
• Database Link:
  NP_005158
  Entrez Gene 333926 Human
  UniProt ID Q5JR12
• Background: PPM1J is the serine/threonine protein phosphatase. The mouse homolog of this protein apparently belongs to the protein phosphatase 2C family. The exact function of this protein is not yet known.This gene encodes the serine/threonine protein phosphatase. The mouse homolog of this gene apparently belongs to the protein phosphatase 2C family of genes. The exact function of this gene is not yet known.
• Synonyms: PP2CZ; PP2Czeta; PPP2CZ
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 85%

Reference Data

• Protein Families: Phosphatase