Antibodies

View as table Download

Rabbit Polyclonal Anti-Ring1A Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Ring1A Antibody: Peptide sequence around aa.35~39( I-A-V-S-P) derived from Human Ring1A.

Anti-RING1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa.35~39( I-A-V-S-P) derived from Human Ring1A.

Rabbit Polyclonal Anti-RING1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RING1 Antibody: synthetic peptide directed towards the middle region of human RING1. Synthetic peptide located within the following region: TGGGGTGGVGGGAGSEDSGDRGGTLGGGTLGPPSPPGAPSPPEPGGEIEL

Rabbit Polyclonal Anti-RING1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RING1 Antibody: synthetic peptide directed towards the middle region of human RING1. Synthetic peptide located within the following region: APSPPEPGGEIELVFRPHPLLVEKGEYCQTRYVKTTGNATVDHLSKYLAL

Rabbit Polyclonal Anti-RING1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RING1 Antibody: synthetic peptide directed towards the N terminal of human RING1. Synthetic peptide located within the following region: MTTPANAQNASKTWELSLYELHRTPQEAIMDGTEIAVSPRSLHSELMCPI

Rabbit Polyclonal Anti-RING1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RING1 Antibody: synthetic peptide directed towards the middle region of human RING1. Synthetic peptide located within the following region: SDTGGPDGCGGEGGGAGGGDGPEEPALPSLEGVSEKQYTIYIAPGGGAFT

RING1A Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RING1A A.
Modifications Unmodified