Antibodies

View as table Download

Rabbit Polyclonal Anti-TFDP2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TFDP2 Antibody: synthetic peptide directed towards the N terminal of human TFDP2. Synthetic peptide located within the following region: MIISTPQRLTSSGSVLIGSPYTPAPAMVTQTHIAEATGWVPGDRKRARKF

Rabbit Polyclonal anti-TFDP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TFDP2 antibody is: synthetic peptide directed towards the C-terminal region of Human TFDP2. Synthetic peptide located within the following region: SVNQGLCLDAEVALATGQFLAPNSHQSSSAASHCSESRGETPCSFNDEDE

Rabbit Polyclonal Anti-TFDP2 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein

TFDP2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein

TFDP2 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 287-386 of human TFDP2 (NP_006277.1).
Modifications Unmodified