Antibodies

View as table Download

Rabbit polyclonal ZNF202 Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ZNF202 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 342-370 amino acids from the Central region of human ZNF202.

Rabbit Polyclonal Anti-ZNF202 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ZNF202 Antibody: synthetic peptide directed towards the N terminal of human ZNF202. Synthetic peptide located within the following region: ATAVEPEDQDLWEEEGILMVKLEDDFTCRPESVLQRDDPVLETSHQNFRR

Rabbit Polyclonal Anti-ZNF202 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ZNF202 Antibody: synthetic peptide directed towards the middle region of human ZNF202. Synthetic peptide located within the following region: LDPTQKEFYGEYVLEEDCGIVVSLSFPIPRPDEISQVREEEPWVPDIQEP

ZNF202 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ZNF202

ZNF202 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ZNF202