ZNF202 Rabbit Polyclonal Antibody

CAT#: TA333999

Rabbit Polyclonal Anti-ZNF202 Antibody

Product Images

WB Suggested Anti-ZNF202 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysateZNF202 is supported by BioGPS gene expression data to be expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZNF202 Antibody: synthetic peptide directed towards the middle region of human ZNF202. Synthetic peptide located within the following region: LDPTQKEFYGEYVLEEDCGIVVSLSFPIPRPDEISQVREEEPWVPDIQEP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 75 kDa
• Gene Name: zinc finger protein 202
• Database Link:
  NP_003446
  Entrez Gene 7753 Human
  UniProt ID O95125
• Background: ZNF202 is a transcriptional repressor that binds to elements found predominantly in genes that participate in lipid metabolism. Among its targets are structural components of lipoprotein particles (apolipoproteins AIV, CIII, and E), enzymes involved in lipid processing (lipoprotein lipase, lecithin cholesteryl ester transferase), transporters involved in lipid homeostasis (ABCA1, ABCG1), and several genes involved in processes related to energy metabolism and vascular disease.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.
• Synonyms: ZKSCAN10; ZSCAN42
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Pig: 92%; Rat: 86%; Guinea pig: 86%; Rabbit: 85%; Mouse: 79%

Reference Data

• Protein Families: Transcription Factors