Rabbit polyclonal ZNF202 Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ZNF202 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 342-370 amino acids from the Central region of human ZNF202. |
Rabbit Polyclonal Anti-ZNF202 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNF202 Antibody: synthetic peptide directed towards the N terminal of human ZNF202. Synthetic peptide located within the following region: ATAVEPEDQDLWEEEGILMVKLEDDFTCRPESVLQRDDPVLETSHQNFRR |
Rabbit Polyclonal Anti-ZNF202 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNF202 Antibody: synthetic peptide directed towards the middle region of human ZNF202. Synthetic peptide located within the following region: LDPTQKEFYGEYVLEEDCGIVVSLSFPIPRPDEISQVREEEPWVPDIQEP |
Carrier-free (BSA/glycerol-free) ZNF202 mouse monoclonal antibody,clone OTI1D12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ZNF202 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ZNF202 |
ZNF202 mouse monoclonal antibody,clone OTI1D12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ZNF202 mouse monoclonal antibody,clone OTI1D12, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
ZNF202 mouse monoclonal antibody,clone OTI1D12, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
ZNF202 mouse monoclonal antibody,clone OTI1D12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
