Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-ADORA1 antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human ADORA1. |
Rabbit Polyclonal Anti-ADORA1 Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | ADORA1 / Adenosine A1 Receptor antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human Adenosine A1 Receptor. Percent identity with other species by BLAST analysis: Human, Orangutan, Monkey (100%); Gibbon, Marmoset, Mouse, Rat, Hamster, Elephant, Dog, Bat, Horse, Rabbit, Guinea pig (95%); Panda, Pig (90%); Bovine (85%). |
Rabbit Polyclonal Anti-ADORA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADORA1 antibody: synthetic peptide directed towards the C terminal of human ADORA1. Synthetic peptide located within the following region: THGNSAMNPIVYAFRIQKFRVTFLKIWNDHFRCQPAPPIDEDLPEERPDD |
Rabbit Polyclonal Anti-ADORA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADORA1 antibody: synthetic peptide directed towards the C terminal of human ADORA1. Synthetic peptide located within the following region: VLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLAL |
Active filters
Target Symbol
- ADORA1
Clonalities
- Polyclonal
Families
- Druggable Genome