Antibodies

Jump to Filters
View as table Download
AMID (AIFM2) (C-term) Rabbit Polyclonal Antibody
AP50123PU-N

USD 450.00

2 Weeks

AMID (AIFM2) (C-term) rabbit polyclonal antibody, Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 326~356 amino acids from the C-terminal region of human AIFM2
AMID (AIFM2) (2-13) Goat Polyclonal Antibody
AP22493PU-N

USD 440.00

2 Weeks

AMID (AIFM2) (2-13) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Human
Immunogen Synthetic peptide from N-term of human AIFM2
AMID (AIFM2) Rabbit Polyclonal Antibody
TA330412

USD 375.00

5 Days

Rabbit Polyclonal Anti-AIFM2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AIFM2 antibody: synthetic peptide directed towards the middle region of human AIFM2. Synthetic peptide located within the following region: GALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTMRQSPP
AMID (AIFM2) Rabbit Polyclonal Antibody
TA309569

USD 410.00

5 Days

Rabbit Polyclonal AMID Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to residues 170-185 [VTLIHSQVALADKELL] of the 41 kDa human PRG3 protein. This sequence is 87% identical in mouse.
AMID (AIFM2) Rabbit Polyclonal Antibody
TA315941

USD 345.00

4 Weeks

Rabbit polyclonal anti-AIFM2 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AIFM2.