Antibodies

View as table Download

C5R1 (C5AR1) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 178-205 amino acids from the Central region of human C5AR1

Rabbit Polyclonal Anti-C5a Anaphylatoxin Receptor (extracellular)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide (C)DKDTLDLNTPVDK, corresponding to amino acid residues 16-28 of human C5aR (Accession P21730 ). Extracellular, N-terminus.

Rabbit Polyclonal Anti-C5AR1 Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen C5AR1 / CD88 / C5a Receptor antibody was raised against synthetic 18 amino acid peptide from internal region of human C5AR1 / CD88. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Monkey (100%); Gibbon (89%).

Rabbit Polyclonal Anti-C5AR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C5AR1 antibody: synthetic peptide directed towards the C terminal of human C5AR1. Synthetic peptide located within the following region: SHDKRRERAVAIVRLVLGFLWPLLTLTICYTFILLRTWSRRATRSTKTLK