Antibodies

View as table Download

Rabbit polyclonal Mlf1 phospho T78 antibody (Phospho-specific)

Applications IHC, WB
Reactivities Bovine, Chimpanzee, Human, Dog
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids surrounding Thr78 of human MLF1IP protein. The immunogen peptide is phosphorylated at Thr78.
Modifications Phospho-specific

Rabbit Polyclonal Anti-CENPU Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MLF1IP antibody is: synthetic peptide directed towards the C-terminal region of Human MLF1IP. Synthetic peptide located within the following region: ISHDKRKKSRSKAIGSDTSDIVHIWCPEGMKTSDIKELNIVLPEFEKTHL

Rabbit polyclonal anti-MLF1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a 200 residue recombinant protein corresponding to the amino terminal end of human MLF1IP protein.

Rabbit polyclonal anti-MLF1 antibody

Applications WB
Reactivities Bovine, Chimpanzee, Human, Dog
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids surrounding Thr78 of human MLF1IP protein.

Rabbit polyclonal MLF1IP / PBIP1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a 418 residue recombinant protein corresponding to the carboxy terminal end of human MLF1IP protein.

Rabbit Polyclonal Anti-CENPU Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MLF1IP antibody is: synthetic peptide directed towards the N-terminal region of Human MLF1IP. Synthetic peptide located within the following region: IYADEEEFSKHCGLSLSSTPPGKEAKRSSDTSGNEASEIESVKISAKKPG

Rabbit Polyclonal Anti-CENPU Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CENPU