Rabbit polyclonal MEKKK 1 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MEKKK 1. |
Rabbit polyclonal MEKKK 1 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MEKKK 1. |
Goat Polyclonal Antibody against MAP4K1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence DVVDPDIFNRDPR-C, from the N Terminus of the protein sequence according to NP_009112. |
Rabbit Polyclonal Anti-MAP4K1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAP4K1 antibody: synthetic peptide directed towards the N terminal of human MAP4K1. Synthetic peptide located within the following region: VHPLRVLFLMTKSGYQPPRLKEKGKWSAAFHNFIKVTLTKSPKKRPSATK |
Anti-MAP4K1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 2-15 amino acids of human mitogen-activated protein kinase kinase kinase kinase 1 |
Anti-MAP4K1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 2-15 amino acids of human mitogen-activated protein kinase kinase kinase kinase 1 |