Antibodies

View as table Download

Rabbit Polyclonal Anti-ADAMTS15 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ADAMTS15

Rabbit Polyclonal Anti-AGXT2L2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human AGXT2L2

Rabbit Polyclonal Anti-AGXT2L2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AGXT2L2 antibody: synthetic peptide directed towards the C terminal of human AGXT2L2. Synthetic peptide located within the following region: KIKHPIVGDVRGVGLFIGVDLIKDEATRTPATEEAAYLVSRLKENYVLLS

Rabbit Polyclonal Anti-AGXT2L2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AGXT2L2 antibody: synthetic peptide directed towards the N terminal of human AGXT2L2. Synthetic peptide located within the following region: QNQVLNTNSRYLHDNIVDYAQRLSETLPEQLCVFYFLNSGSEANDLALRL