DAPP1 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
DAPP1 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Goat Anti-DAPP1 / BAM32 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KLSQIRKQLNQGE, from the internal region (near C Terminus) of the protein sequence according to NP_055210.2. |
Rabbit Polyclonal Anti-DAPP1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DAPP1 antibody: synthetic peptide directed towards the middle region of human DAPP1. Synthetic peptide located within the following region: SLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETG |
Rabbit Polyclonal Anti-DAPP1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DAPP1 antibody: synthetic peptide directed towards the middle region of human DAPP1. Synthetic peptide located within the following region: KHFANQPLIGSETGTLMVLKHPYPRKVEEPSIYESVRVHTAMQTGRTEDD |