Antibodies

Jump to Filters
View as table Download
USP38 Rabbit Polyclonal Antibody
TA312644

USD 345.00

In Stock

Rabbit polyclonal anti-USP38 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human USP38.
USP38 Rabbit Polyclonal Antibody
TA342575

USD 375.00

5 Days

Rabbit Polyclonal Anti-USP38 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-USP38 antibody: synthetic peptide directed towards the middle region of human USP38. Synthetic peptide located within the following region: LVNKDVPQKPGGETTPSVTDLLNYFLAPEILTGDNQYYCENCASLQNAEK