Antibodies

View as table Download

Rabbit polyclonal anti-GRK6 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human GRK6.

Rabbit Polyclonal GRK6 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GRK6 antibody was raised against a 19 amino acid peptide near the carboxy terminus of human GRK6.

Rabbit Polyclonal Anti-GRK6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GRK6 antibody is: synthetic peptide directed towards the C-terminal region of Human GRK6. Synthetic peptide located within the following region: LYEMIAGQSPFQQRKKKIKREEVERLVKEVPEEYSERFSPQARSLCSQLL