Rabbit Polyclonal Anti-HSPB8 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human HSPB8 |
Rabbit Polyclonal Anti-HSPB8 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human HSPB8 |
Rabbit Polyclonal antibody to HSP22 (heat shock 22kDa protein 8)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 134 and 196 of HSP22 (Uniprot ID#Q9UJY1) |
Goat Polyclonal Antibody against HSPB8
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence NELPQDSQEVTCT, from the C Terminus of the protein sequence according to NP_055180.1. |
Rabbit Polyclonal Anti-HSPB8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HSPB8 antibody: synthetic peptide directed towards the N terminal of human HSPB8. Synthetic peptide located within the following region: ADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDW |
Rabbit Polyclonal Anti-HSPB8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HSPB8 antibody: synthetic peptide directed towards the middle region of human HSPB8. Synthetic peptide located within the following region: PEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFA |