Rabbit Polyclonal Anti-ASPN Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ASPN antibody: synthetic peptide directed towards the middle region of human ASPN. Synthetic peptide located within the following region: NKISTVELEDFKRYKELQRLGLGNNKITDIENGSLANIPRVREIHLENNK |
Rabbit polyclonal ASPN Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ASPN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 242-269 amino acids from the Central region of human ASPN. |
Rabbit Polyclonal Anti-ASPN Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ASPN |
Germany
Japan
United Kingdom
China
