Antibodies

View as table Download

Rabbit polyclonal anti-BCLAF1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human BCLAF1.

BTF (BCLAF1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 658-688 amino acids from the C-terminal region of human BCLAF1

Rabbit Polyclonal Anti-BCLAF1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen BCLAF1 antibody was raised against a 19 amino acid peptide near the carboxy terminus of human BCLAF1. The immunogen is located within amino acids 820 - 870 of BCLAF1.

Rabbit Polyclonal Anti-Bclaf1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Bclaf1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: TDGDWDDQEVLDYFSDKESAKQKFHDSEGDDTEETEDYRQFRKSVLADQG

Rabbit Polyclonal Anti-BCLAF1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human BCLAF1