Antibodies

Jump to Filters
View as table Download
CITED2 Rabbit Polyclonal Antibody
TA319813

USD 430.00

5 Days

Rabbit Polyclonal CITED2 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CITED2 antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human CITED2.
CITED2 (C-term) Rabbit Polyclonal Antibody
AP50928PU-N

USD 450.00

2 Weeks

CITED2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 207-234 amino acids from the C-terminal region of human CITED2
CITED2 Rabbit Polyclonal Antibody
TA319054

USD 450.00

3 Weeks

Rabbit polyclonal anti-CITED2 antibody (NT)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CITED2 antibody was raised against an 18 amino acid peptide near the amino terminus of human CITED2.
CITED2 Rabbit Polyclonal Antibody
TA339120

USD 375.00

5 Days

Rabbit Polyclonal Anti-CITED2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CITED2 antibody: synthetic peptide directed towards the N terminal of human CITED2. Synthetic peptide located within the following region: HIHYGAGNMNATSGIRHAMGPGTVNGGHPPSALAPAARFNNSQFMGPPVA
CITED2 Rabbit Polyclonal Antibody
TA343581

USD 375.00

5 Days

Rabbit Polyclonal Anti-CITED2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CITED2 antibody: synthetic peptide directed towards the N terminal of human CITED2. Synthetic peptide located within the following region: ADHMMAMNHGRFPDGTNGLHHHPAHRMGMGQFPSPHHHQQQQPQHAFNAL