Antibodies

Jump to Filters
View as table Download
Heat Shock Factor 2 Binding Protein (HSF2BP) Rabbit Polyclonal Antibody
TA338116

USD 310.00

5 Days

Rabbit Polyclonal Anti-HSF2BP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HSF2BP antibody: synthetic peptide directed towards the N terminal of human HSF2BP. Synthetic peptide located within the following region: RHMGTKEEFVKVRKKDLERLTTEVMQIRDFLPRILNGEVLESFQKLKIVE
Heat Shock Factor 2 Binding Protein (HSF2BP) Rabbit Polyclonal Antibody
TA338117

USD 375.00

5 Days

Rabbit Polyclonal Anti-HSF2BP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HSF2BP antibody: synthetic peptide directed towards the N terminal of human HSF2BP. Synthetic peptide located within the following region: EQLKMDCEHFKARLETVQADNIREKKEKLALRQQLNEAKQQLLQQAEYCT