Heat Shock Factor 2 Binding Protein (HSF2BP) Rabbit Polyclonal Antibody

CAT#: TA338117

Rabbit Polyclonal Anti-HSF2BP Antibody

Product Images

WB Suggested Anti-HSF2BP Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human Lung

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HSF2BP antibody: synthetic peptide directed towards the N terminal of human HSF2BP. Synthetic peptide located within the following region: EQLKMDCEHFKARLETVQADNIREKKEKLALRQQLNEAKQQLLQQAEYCT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: heat shock transcription factor 2 binding protein
• Database Link:
  NP_008962
  Entrez Gene 11077 Human
  UniProt ID O75031
• Background: HSF2 binding protein (HSF2BP) associates with HSF2. The interaction occurs between the trimerization domain of HSF2 and the amino terminal hydrophilic region of HSF2BP that comprises two leucine zipper motifs. HSF2BP may therefore be involved in modulating HSF2 activation. HSF2 binding protein (HSF2BP) associates with HSF2. The interaction occurs between the trimerization domain of HSF2 and the amino terminal hydrophilic region of HSF2BP that comprises two leucine zipper motifs. HSF2BP may therefore be involved in modulating HSF2 activation.
• Synonyms: heat shock factor 2 binding protein; heat shock transcription factor 2 binding protein
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 86%; Mouse: 86%; Bovine: 86%; Rat: 85%; Dog: 79%; Rabbit: 79%

Reference Data

• Protein Families: Transcription Factors