Germany
Japan
United Kingdom
China
Antibodies
View as table Download
GPR44 / CRTH2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | GPR44 / CRTH2 antibody was raised against synthetic 33 amino acid peptide from N-terminal extracellular domain of human GPR44 / CRTH2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (91%); Dog, Pig (88%); Rabbit (85%); Bovine (82%). |
GRPR Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Dog, Gorilla, Horse, Human, Monkey, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | GRPR antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human GRPR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Panda, Dog, Bat, Horse, Rabbit, Pig (100%); Bovine (94%); Mouse, Rat, Hamster (83%). |
B1R / BDKRB1 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | B1R / BDKRB1 antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Horse (81%). |
Goat Polyclonal Anti-CD45 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 1,260 aa to the C-terminus of human CD45 produced in E. coli. |
Goat Polyclonal Anti-CD19 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide within residues 510 aa to the C-terminus of human CD19 produced in E. coli. |
Dopamine D2 Receptor / DRD2 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Chimpanzee, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | DRD2 / Dopamine Receptor D2 antibody was raised against synthetic 19 amino acid peptide from 3rd cytoplasmic domain of human DRD2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Marmoset (100%); Gibbon, Monkey, Rabbit (95%); Dog, Bovine, Panda, Horse, Pig (89%); Mouse, Rat, Ferret, Bat, Hamster, Elephant (84%). |
Rabbit Polyclonal Anti-HSD3B1 Antibody
| Applications | WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSD3B1 antibody: synthetic peptide directed towards the N terminal of human HSD3B1. Synthetic peptide located within the following region: TGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQ |
Goat Polyclonal Anti-CD4 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within 50 to 235 aa, corresponding to the external domain of human CD4 produced in E. coli. |
Dopamine Receptor D3 / DRD3 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Chimpanzee, Gorilla, Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | DRD3 / Dopamine Receptor D3 antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human DRD3 / Dopamine Receptor D3. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Monkey, Marmoset (100%); Gibbon, Mouse, Dog, Bovine, Bat, Hamster, Elephant, Panda, Horse, Rabbit (94%); Rat, Pig, Opossum (88%). |
Goat Polyclonal Anti-CD31 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide within residues 690 aa to the C-terminus of human CD31 produced in E. coli. |
Dopamine Receptor D1 / DRD1 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | DRD1 / Dopamine Receptor D1 antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human DRD1. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon, Marmoset (95%); Elephant (90%); Dog, Rabbit (85%); Horse (80%). |
Goat Polyclonal Anti-CDH1 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified Recombinant peptide derived from within residues 601 to 701 of human CDH1 produced in E. coli. |
GPR183 / EBI2 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | GPR183 / EBI2 antibody was raised against synthetic 15 amino acid peptide from C-terminus of human GPR183 / EBI2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Pig (93%); Opossum, Platypus, Catfish, Zebrafish (80%). |
TRPV2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Horse, Human, Monkey, Pig |
| Conjugation | Unconjugated |
| Immunogen | VRL1 / TRPV2 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human TRPV2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Horse, Pig (100%); Gibbon, Bovine, Hamster, Panda, Rabbit (93%); Mouse, Dog (87%); Elephant (80%). |
Rabbit Polyclonal Anti-SRD5A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SRD5A2 antibody: synthetic peptide directed towards the N terminal of human SRD5A2. Synthetic peptide located within the following region: MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR |
ADRB3 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ADRB3 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human ADRB3. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Monkey (94%). |
Rabbit anti-S100A10 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Monkey |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human S100A10 |
USD 425.00
In Stock
CHRM3 / M3 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Monkey, Orang-Utan |
| Conjugation | Unconjugated |
| Immunogen | CHRM3 / M3 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human CHRM3 / M3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Chimpanzee, Mouse, Rat, Sheep, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Pig, Guinea pig (95%); Opossum, Turkey, Chicken, Lizard (89%). |
FPR2 / FPRL1 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | FPR2 / FPRL1 antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human FPR2 / FPRL1. Percent identity with other species by BLAST analysis: Human (100%); Chimpanzee, Gorilla, Monkey (95%); Orangutan (90%); Dog (85%). |
B1R / BDKRB1 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Human, Monkey, Gorilla |
| Conjugation | Unconjugated |
| Immunogen | B1R / BDKRB1 antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon (94%); Rat, Hamster (89%); Mouse, Rabbit, Horse (83%). |
Rabbit polyclonal CD38 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD38 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 241-270 amino acids from the C-terminal region of human CD38. |
Goat Polyclonal Anti-CDH1 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 750 to 850 of human CDH1 produced in E. coli. |
Goat Polyclonal Anti-ERBB2 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 1,177 aa to the C-terminus of human ERBB2 produced in E. coli. |
CALCRL / CRLR Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Xenopus, Gorilla, Goat, Hamster, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | CALCRL / CGRP Receptor antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human CALCRL. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rat, Goat, Hamster, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum, Xenopus (100%); Mouse, Elephant, Bat, Guinea pig, Stickleback, Pufferfish, Zebrafish (94%); Turkey, Chicken (81%). |
CALCRL / CRLR Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Orang-Utan |
| Conjugation | Unconjugated |
| Immunogen | CALCRL / CGRP Receptor antibody was raised against synthetic 15 amino acid peptide from N-terminal extracellular domain of human CALCRL. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Marmoset, Mouse, Rabbit (93%); Rat, Panda, Dog, Horse, Pig (87%); Goat, Bovine (80%). |
CCR6 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human, Monkey, Gorilla, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | CCR6 antibody was raised against synthetic 20 amino acid peptide from C-terminus of human CCR6. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Mouse, Rat, Horse (80%). |
ILEI / FAM3C Rabbit Polyclonal (aa40-80) Antibody
| Applications | IHC |
| Reactivities | Bovine, Chimpanzee, Chicken, Human, Monkey, Mouse, Opossum, Rat, Dog, Pufferfish |
| Conjugation | Unconjugated |
| Immunogen | ILEI / FAM3C antibody was raised against synthetic peptide from human FAM3C. |
Anti-Hepsin Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Dog, Gorilla, Human, Monkey, Orang-Utan, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | HPN / TMPRSS1 / Hepsin antibody was raised against human hepsin amino acids 241-260 (GGYLPFRDPNSEENSNDIAL). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Bovine, Dog, Bat, Panda, Rabbit (100%); Opossum (95%); Hamster, Horse (90%); Mouse, Rat (85%); Xenopus (80%). |
MRGPRX2 / MRGX2 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | MRGPRX2 / MRGX2 antibody was raised against synthetic 16 amino acid peptide from 3rd extracellular domain of human MRGPRX2 / MRGX2. Percent identity with other species by BLAST analysis: Human (100%); Chimpanzee, Gorilla, Monkey (94%); Orangutan (88%); Gibbon (81%). |
NPBWR2 / GPR8 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | NPBWR2 / GPR8 antibody was raised against synthetic 17 amino acid peptide from N-terminal extracellular domain of human NPBWR2. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey, Marmoset (94%); Gibbon (88%). |
GPR80 / OXGR1 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | GPR80 / GPR99 / OXGR1 antibody was raised against synthetic 17 amino acid peptide from 2nd extracellular domain of human OXGR1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Marmoset (100%); Monkey, Mouse, Rat, Rabbit (94%); Dog, Bat, Hamster, Panda, Horse (88%). |
PGES / PTGES Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Monkey, Mouse, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | PGES / PTGES antibody was raised against synthetic 16 amino acid peptide from N-Terminus of human PTGES. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Elephant, Rabbit, Pig (100%); Hamster, Bovine (94%); Dog, Horse, Turkey, Chicken (88%); Pike (81%). |
LGR7 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human, Orang-Utan |
| Conjugation | Unconjugated |
| Immunogen | RXFP1/ LGR7 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human RXFP1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan (100%); Gibbon, Monkey (95%); Marmoset (84%). |
ZIP14 / SLC39A14 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Chimpanzee, Dog, Gorilla, Horse, Human, Pig |
| Conjugation | Unconjugated |
| Immunogen | SLC39A14 / ZIP14 antibody was raised against synthetic 15 amino acid peptide from internal region of human SLC39A14. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Panda, Dog, Bat, Horse, Pig (100%); Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Hamster, Bovine (93%); Elephant (87%); Rat, Rabbit, Guinea pig (80%). |
ZIP14 / SLC39A14 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Monkey, Orang-Utan, Pig |
| Conjugation | Unconjugated |
| Immunogen | SLC39A14 / ZIP14 antibody was raised against synthetic 15 amino acid peptide from cytoplasmic domain of human SLC39A14. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Pig (100%); Bovine, Dog, Hamster, Elephant, Panda (93%); Rat, Bat, Rabbit, Horse, Opossum (87%); Mouse (80%). |
Active filters
Reactivities
- Monkey
Isotypes
- IgG
Clonalities
- Polyclonal
Families
- Transmembrane
Filter by
Category
Target Symbol
- CANX (4)
- ENPP3 (3)
- ENTPD2 (3)
- GJA1 (3)
- GLG1 (3)
- GPR4 (3)
- OXGR1 (3)
- SLC1A4 (3)
- ADRA1B (2)
- BDKRB1 (2)
- BEST4 (2)
- CALCRL (2)
- CCKAR (2)
- CCR4 (2)
- CD19 (2)
- CD63 (2)
- CD70 (2)
- CDH1 (2)
- CNR2 (2)
- DRD2 (2)
- DRD3 (2)
- FFAR4 (2)
- GPR65 (2)
- GRPR (2)
- HCAR1 (2)
- HCRTR1 (2)
- KCNJ6 (2)
- KCNMA1 (2)
- PTGES (2)
- PTH2R (2)
- PTPRC (2)
- SLC11A2 (2)
- SLC1A5 (2)
- SLC39A14 (2)
- SLC5A9 (2)
- SLC6A3 (2)
- SRD5A2 (2)
- SURF4 (2)
- TAS1R1 (2)
- TM9SF3 (2)
- TSPAN13 (2)
- WNT10A (2)
- WNT4 (2)
- ABCB1 (1)
- ADGRL3 (1)
- ADRB2 (1)
- ADRB3 (1)
- AGTR2 (1)
- APP (1)
- AVPR1B (1)
- BAX (1)
- BEST2 (1)
- BSG (1)
- CCR6 (1)
- CD1B (1)
- CD1D (1)
- CD2 (1)
- CD247 (1)
- CD36 (1)
- CD38 (1)
- CD4 (1)
- CD40 (1)
- CDH2 (1)
- CHRM3 (1)
- CLGN (1)
- DRD1 (1)
- DRD5 (1)
- EGFR (1)
- ERBB2 (1)
- FAM3C (1)
- FPR2 (1)
- GALR1 (1)
- GANAB (1)
- GHSR (1)
- GLP2R (1)
- GPR137B (1)
- GPR183 (1)
- GPR3 (1)
- GPR39 (1)
- GPR55 (1)
- GPR61 (1)
- GPR84 (1)
- GPR88 (1)
- GPRC6A (1)
- GRM2 (1)
- GRM7 (1)
- HPN (1)
- HRH3 (1)
- HSD3B1 (1)
- HSD3B2 (1)
- HTR6 (1)
- ICAM2 (1)
- IL1R2 (1)
- INSR (1)
- ITGA3 (1)
- KCNH2 (1)
- KIAA1324 (1)
- LPAR4 (1)
- LRP12 (1)
- LTB4R2 (1)
Antibody Hosts
Conjugates
Pathways
- Neuroactive ligand-receptor interaction (45)
- Calcium signaling pathway (21)
- Pathways in cancer (15)
- Cell adhesion molecules (CAMs) (14)
- Hematopoietic cell lineage (11)
- Cytokine-cytokine receptor interaction (10)
- Metabolic pathways (10)
- Basal cell carcinoma (9)
- Hedgehog signaling pathway (9)
- Melanogenesis (9)
- Wnt signaling pathway (9)
- Gap junction (7)
- Vascular smooth muscle contraction (7)
- Adherens junction (6)
- Primary immunodeficiency (6)
- Purine metabolism (6)
- Antigen processing and presentation (5)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (5)
- Regulation of actin cytoskeleton (5)
- T cell receptor signaling pathway (5)
- Androgen and estrogen metabolism (4)
- Bladder cancer (4)
- Chemokine signaling pathway (4)
- Endometrial cancer (4)
- Lysosome (4)
- Nicotinate and nicotinamide metabolism (4)
- Prostate cancer (4)
- Endocytosis (3)
- Focal adhesion (3)
- MAPK signaling pathway (3)
- Melanoma (3)
- Natural killer cell mediated cytotoxicity (3)
- Pantothenate and CoA biosynthesis (3)
- Parkinson's disease (3)
- Riboflavin metabolism (3)
- Starch and sucrose metabolism (3)
- Adipocytokine signaling pathway (2)
- Allograft rejection (2)
- Alzheimer's disease (2)
- Amyotrophic lateral sclerosis (ALS) (2)
- Apoptosis (2)
- Arachidonic acid metabolism (2)
- Asthma (2)
- B cell receptor signaling pathway (2)
- C21-Steroid hormone metabolism (2)
- Colorectal cancer (2)
- Complement and coagulation cascades (2)
- Dilated cardiomyopathy (2)
- ECM-receptor interaction (2)
- ErbB signaling pathway (2)
- Fc gamma R-mediated phagocytosis (2)
- Huntington's disease (2)
- Hypertrophic cardiomyopathy (HCM) (2)
- Non-small cell lung cancer (2)
- Pancreatic cancer (2)
- Pathogenic Escherichia coli infection (2)
- Systemic lupus erythematosus (2)
- Taste transduction (2)
- Thyroid cancer (2)
- Toll-like receptor signaling pathway (2)
- Type II diabetes mellitus (2)
- ABC transporters (1)
- Autoimmune thyroid disease (1)
- Caffeine metabolism (1)
- Dorso-ventral axis formation (1)
- Drug metabolism - other enzymes (1)
- Epithelial cell signaling in Helicobacter pylori infection (1)
- Fc epsilon RI signaling pathway (1)
- Glioma (1)
- GnRH signaling pathway (1)
- Graft-versus-host disease (1)
- Insulin signaling pathway (1)
- Leukocyte transendothelial migration (1)
- N-Glycan biosynthesis (1)
- NOD-like receptor signaling pathway (1)
- Neurotrophin signaling pathway (1)
- PPAR signaling pathway (1)
- Prion diseases (1)
- RIG-I-like receptor signaling pathway (1)
- Renin-angiotensin system (1)
- SNARE interactions in vesicular transport (1)
- Small cell lung cancer (1)
- TGF-beta signaling pathway (1)
- Type I diabetes mellitus (1)
- Viral myocarditis (1)
- p53 signaling pathway (1)