Germany
Japan
United Kingdom
China
SRD5A2 Rabbit Polyclonal Antibody
Product Images
Other products for "SRD5A2"
Specifications
| Product Data | |
| Applications | IHC, WB |
| Recommended Dilution | IHC, WB |
| Reactivities | Human, Monkey |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-SRD5A2 antibody: synthetic peptide directed towards the N terminal of human SRD5A2. Synthetic peptide located within the following region: MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 28 kDa |
| Gene Name | steroid 5 alpha-reductase 2 |
| Database Link | |
| Background | This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result in male pseudohermaphroditism, specifically pseudovaginal perineoscrotal hypospadias (PPSH). [provided by RefSeq, Jul 2008] |
| Synonyms | MGC138457 |
| Note | Immunogen Sequence Homology: Human: 100%; Rabbit: 91%; Pig: 86% |
| Reference Data | |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Androgen and estrogen metabolism, Prostate cancer |
Documents
| Product Manuals |
| FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.