Antibodies

View as table Download

CDS1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat
Immunogen Synthetic peptide corresponding to the N-terminal region of human CDS1

Rabbit polyclonal anti-DGKE antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DGKE.

DGKE rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

ITPR2 (1152-1164) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Human, Monkey
Immunogen Synthetic peptide from an internal region of human ITPR2

Rabbit Polyclonal Anti-DGKE Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DGKE antibody: synthetic peptide directed towards the N terminal of human DGKE. Synthetic peptide located within the following region: EAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHR

Rabbit Polyclonal Anti-CDS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CDS2 antibody is: synthetic peptide directed towards the C-terminal region of Human CDS2. Synthetic peptide located within the following region: EYNNDTNSFTVDCEPSDLFRLQEYNIPGVIQSVIGWKTVRMYPFQIHSIA

Rabbit Polyclonal Anti-ITPR1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ITPR1

Rabbit Polyclonal Anti-ITPR2 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ITPR2

Rabbit Polyclonal Anti-ITPR3 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ITPR3

CDS1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CDS1

CDS1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CDS1