DGKE Rabbit Polyclonal Antibody

CAT#: TA338224

Rabbit Polyclonal Anti-DGKE Antibody

Product Images

WB Suggested Anti-DGKE Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Human brain

• 

  DGKE antibody - N-terminal region validated by WB using lymph at 1: 1000.

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DGKE antibody: synthetic peptide directed towards the N terminal of human DGKE. Synthetic peptide located within the following region: EAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 64 kDa
• Gene Name: diacylglycerol kinase epsilon
• Database Link:
  NP_003638
  Entrez Gene 56077 MouseEntrez Gene 8526 Human
  UniProt ID P52429
• Background: Diacylglycerol kinases are thought to be involved mainly in the regeneration of phosphatidylinositol (PI) from diacylglycerol in the PI-cycle during cell signal transduction. When expressed in mammalian cells, DGK-epsilon shows specificity for arachidonyl-containing diacylglycerol. DGK-epsilon is expressed predominantly in testis. [provided by RefSeq, Jul 2008]
• Synonyms: AHUS7; DAGK5; DAGK6; DGK; NPHS7
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 77%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Glycerolipid metabolism, Glycerophospholipid metabolism, Metabolic pathways, Phosphatidylinositol signaling system