Antibodies

View as table Download

Rabbit Polyclonal Anti-TMEM16A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TMEM16A antibody: synthetic peptide directed towards the middle region of human TMEM16A. Synthetic peptide located within the following region: HGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKY

Rabbit Polyclonal TMEM16A Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen TMEM16A antibody was raised against a 17 amino acid peptide from near the amino terminus of human TMEM16A.

Rabbit Polyclonal Anti-ANO1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ANO1

Rabbit Polyclonal TMEM16B Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen TMEM16B antibody was raised against a 19 amino acid peptide from near the amino terminus of human TMEM16B.

Rabbit Polyclonal DOG1/TMEM16A Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Rabbit polyclonal anti-ANO1 / TM16A antibody

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human TM16A.