TMEM16A (ANO1) Rabbit Polyclonal Antibody

CAT#: TA344148

Rabbit Polyclonal Anti-TMEM16A Antibody

Product Images

WB Suggested Anti-TMEM16A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Human Muscle

• 

  Host: Rabbit; Target Name: TMEM16A; Sample Tissue: Human Fetal Muscle; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide; Primary Antibody Concentration: 1 ug/ml; Peptide Concentration: 5 ug/ml; Lysate Quantity: 25 ug/lane/lane; Gel Co

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TMEM16A antibody: synthetic peptide directed towards the middle region of human TMEM16A. Synthetic peptide located within the following region: HGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 111 kDa
• Gene Name: anoctamin 1
• Database Link:
  NP_060513
  Entrez Gene 55107 Human
  UniProt ID Q5XXA6
• Background: TMEM16A belongs to the anoctamin family. TMEM16A acts as a calcium-activated chloride channel. It is required for normal tracheal development.
• Synonyms: DOG1; ORAOV2; TAOS2; TMEM16A
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 79%

Reference Data

• Protein Families: Transmembrane