Rabbit Polyclonal Anti-LASS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LASS2 antibody: synthetic peptide directed towards the N terminal of human LASS2. Synthetic peptide located within the following region: MLQTLYDYFWWERLWLPVNLTWADLEDRDGRVYAKASDLYITLPLALLFL |
Anti-CERS2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 100-114 amino acids of human ceramide synthase 2 |
Rabbit Polyclonal Anti-LASS2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LASS2 antibody: synthetic peptide directed towards the N terminal of human LASS2. Synthetic peptide located within the following region: EKTRLRAPPNATLEHFYLTSGKQPKQVEVELLSRQSGLSGRQVERWFRRR |
Rabbit Polyclonal Anti-LASS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LASS2 antibody: synthetic peptide directed towards the N terminal of human LASS2. Synthetic peptide located within the following region: IVRYFFELYVATPLAALLNIKEKTRLRAPPNATLEHFYLTSGKQPKQVEV |
Germany
Japan
United Kingdom
China
