Antibodies

Jump to Filters
View as table Download
CHRNB3 Goat Polyclonal Antibody
TA303358

USD 375.00

5 Days

Goat Polyclonal Antibody against CHRNB3

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SRHVKKEHFISQ, from the internal region of the protein sequence according to NP_000740.1.
CHRNB3 Rabbit Polyclonal Antibody
TA330428

USD 375.00

5 Days

Rabbit Polyclonal Anti-CHRNB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRNB3 antibody: synthetic peptide directed towards the middle region of human CHRNB3. Synthetic peptide located within the following region: YDGTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYSYPFITY