CHRNB3 Rabbit Polyclonal Antibody

CAT#: TA330428

Rabbit Polyclonal Anti-CHRNB3 Antibody

Product Images

WB Suggested Anti-CHRNB3 Antibody Titration: 0.03ug/ml; ELISA Titer: 1:1562500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CHRNB3 antibody: synthetic peptide directed towards the middle region of human CHRNB3. Synthetic peptide located within the following region: YDGTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYSYPFITY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 53 kDa
• Gene Name: cholinergic receptor nicotinic beta 3 subunit
• Database Link:
  NP_000740
  Entrez Gene 1142 Human
  UniProt ID Q05901
• Background: Nicotinic acetylcholine receptors (nAChRs) are ligand-gated ion channels nAChRs are pentameric structures that are made up of combinations of individual subunits. CHRNB3 is one of the subunits of nAChR. Twelve neuronal nAChR subunits have been described, alpha2-alpha10 and beta2-beta4. CHRNB3 decreased the channel mean open time and burst length. There was also an increase in single channel slope conductance. On the other hand, the calcium permeability and the pharmacological properties of beta3-containing receptors differed little from those of without beta3. Dysfunction of nAChR has been linked to a number of human diseases such as schizophrenia, Alzheimer's and Parkinson's diseases. nAChRs also play a significant role in nicotine addiction.
• Synonyms: acetylcholine receptor; beta-3 subunit; beta 3; beta polypeptide 3; cholinergic receptor; neuronal nicotinic; nicotinic
• Note: Immunogen sequence homology: Bovine: 100%; Chicken: 100%; Dog: 100%; Guinea pig: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Horse: 93%; African clawed frog: 76%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Cys-loop Receptors, Transmembrane