Antibodies

Jump to Filters
View as table Download
CLEC4F (C-term) Rabbit Polyclonal Antibody
AP50963PU-N

USD 450.00

2 Weeks

CLEC4F (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 318-347 amino acids from the C-terminal region of human CLEC4F
CLEC4F Rabbit Polyclonal Antibody
TA331595

USD 375.00

5 Days

Rabbit Polyclonal Anti-CLEC4F Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CLEC4F Antibody is: synthetic peptide directed towards the C-terminal region of Human CLEC4F. Synthetic peptide located within the following region: LRGHLERAGDEIHVLKRDLKMVTAQTQKANGRLDQTDTQIQVFKSEMENV
CLEC4F Rabbit Polyclonal Antibody
TA331596

USD 375.00

5 Days

Rabbit Polyclonal Anti-CLEC4F Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CLEC4F Antibody is: synthetic peptide directed towards the C-terminal region of Human CLEC4F. Synthetic peptide located within the following region: DSNLQKASAEIQRLRGDLENTKALTMEIQQEQSRLKTLHVVITSQEQLQR