CLEC4F Rabbit Polyclonal Antibody

CAT#: TA331595

Rabbit Polyclonal Anti-CLEC4F Antibody

Product Images

Host: Rabbit; Target Name: CLEC4F; Sample Tissue: Jurkat Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CLEC4F Antibody is: synthetic peptide directed towards the C-terminal region of Human CLEC4F. Synthetic peptide located within the following region: LRGHLERAGDEIHVLKRDLKMVTAQTQKANGRLDQTDTQIQVFKSEMENV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 65 kDa
• Gene Name: C-type lectin domain family 4 member F
• Database Link:
  NP_775806
  Entrez Gene 165530 Human
  UniProt ID Q8N1N0
• Background: CLEC4F is a receptor with an affinity for galactose and fucose. It could be involved in endocytosis.
• Synonyms: CLECSF13; KCLR
• Note: Immunogen sequence homology: Human: 100%; Mouse: 86%

Reference Data

• Protein Families: Druggable Genome, Transmembrane