CLEC4F Rabbit Polyclonal Antibody

CAT#: TA331595

Rabbit Polyclonal Anti-CLEC4F Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "CLEC4F"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-CLEC4F Antibody is: synthetic peptide directed towards the C-terminal region of Human CLEC4F. Synthetic peptide located within the following region: LRGHLERAGDEIHVLKRDLKMVTAQTQKANGRLDQTDTQIQVFKSEMENV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 65 kDa
Gene Name C-type lectin domain family 4 member F
Background CLEC4F is a receptor with an affinity for galactose and fucose. It could be involved in endocytosis.
Synonyms CLECSF13; KCLR
Note Immunogen sequence homology: Human: 100%; Mouse: 86%
Reference Data
Protein Families Druggable Genome, Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.