Antibodies

Jump to Filters
View as table Download
Zinc Alpha 2 Glycoprotein (AZGP1) Rabbit Polyclonal Antibody
TA332643

USD 275.00

3 Weeks

Rabbit anti-AZGP1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human AZGP1
Zinc Alpha 2 Glycoprotein (AZGP1) Rabbit Polyclonal Antibody
TA344276

USD 475.00

5 Days

Rabbit Polyclonal Anti-AZGP1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AZGP1 antibody: synthetic peptide directed towards the N terminal of human AZGP1. Synthetic peptide located within the following region: MVRMVPVLLSLLLLLGPAVPQENQDGRYSLTYIYTGLSKHVEDVPAFQAL