Zinc Alpha 2 Glycoprotein (AZGP1) Rabbit Polyclonal Antibody

CAT#: TA344276

Rabbit Polyclonal Anti-AZGP1 Antibody - N-terminal region

Product Images

WB Suggested Anti-AZGP1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human heart

• 

  Host: Rabbit; Target Name: AZGP1; Sample Tissue: 293T; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-AZGP1 antibody: synthetic peptide directed towards the N terminal of human AZGP1. Synthetic peptide located within the following region: MVRMVPVLLSLLLLLGPAVPQENQDGRYSLTYIYTGLSKHVEDVPAFQAL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 33 kDa
• Gene Name: alpha-2-glycoprotein 1, zinc-binding
• Database Link:
  NP_001176
  Entrez Gene 563 Human
  UniProt ID P25311
• Background: Stimulates lipid degradation in adipocytes and causes the extensive fat losses associated with some advanced cancers. AZGP1 may bind polyunsaturated fatty acids.
• Synonyms: ZA2G; ZAG
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 79%

Reference Data

• Protein Families: Secreted Protein