Rabbit Polyclonal Anti-CAMK1G Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CAMK1G antibody: synthetic peptide directed towards the middle region of human CAMK1G. Synthetic peptide located within the following region: KDFICHLLEKDPNERYTCEKALSHPWIDGNTALHRDIYPSVSLQIQKNFA |
Rabbit Polyclonal Anti-CAMK1G Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CAMK1G antibody: synthetic peptide directed towards the N terminal of human CAMK1G. Synthetic peptide located within the following region: SEVFLVKQRLTGKLFALKCIKKSPAFRDSSLENEIAVLKKIKHENIVTLE |
CAMK1G Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 217-476 of human CAMK1G (NP_065172.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
