CaMKI gamma (CAMK1G) Rabbit Polyclonal Antibody

CAT#: TA344778

Rabbit Polyclonal Anti-CAMK1G Antibody - middle region

Product Images

WB Suggested Anti-CAMK1G Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CAMK1G antibody: synthetic peptide directed towards the middle region of human CAMK1G. Synthetic peptide located within the following region: KDFICHLLEKDPNERYTCEKALSHPWIDGNTALHRDIYPSVSLQIQKNFA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 53 kDa
• Gene Name: calcium/calmodulin dependent protein kinase IG
• Database Link:
  NP_065172
  Entrez Gene 57172 Human
  UniProt ID Q96NX5
• Background: This gene encodes a protein similar to calcium/calmodulin dependent protein kinase, however, its exact function is not known.
• Synonyms: CLICK3; CLICKIII; dJ272L16.1; VWS1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase