CaMKI gamma (CAMK1G) Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human calcium/calmodulin-dependent protein kinase IG (CAMK1G)
USD 823.00
Transient overexpression lysate of calcium/calmodulin-dependent protein kinase IG (CAMK1G)
USD 396.00
Other products for "CAMK1G"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CAMK1G antibody: synthetic peptide directed towards the middle region of human CAMK1G. Synthetic peptide located within the following region: KDFICHLLEKDPNERYTCEKALSHPWIDGNTALHRDIYPSVSLQIQKNFA |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 53 kDa |
Gene Name | calcium/calmodulin dependent protein kinase IG |
Database Link | |
Background | This gene encodes a protein similar to calcium/calmodulin dependent protein kinase, however, its exact function is not known. |
Synonyms | CLICK3; CLICKIII; dJ272L16.1; VWS1 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93% |
Reference Data | |
Protein Families | Druggable Genome, Protein Kinase |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.