Rabbit Polyclonal Anti-CAMK1G Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CAMK1G antibody: synthetic peptide directed towards the middle region of human CAMK1G. Synthetic peptide located within the following region: KDFICHLLEKDPNERYTCEKALSHPWIDGNTALHRDIYPSVSLQIQKNFA |
Rabbit Polyclonal Anti-CAMK1G Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CAMK1G antibody: synthetic peptide directed towards the N terminal of human CAMK1G. Synthetic peptide located within the following region: SEVFLVKQRLTGKLFALKCIKKSPAFRDSSLENEIAVLKKIKHENIVTLE |
Rabbit Polyclonal Antibody against CAMK1G (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CAMK1G (CaMKI gamma) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 420-450 amino acids from the C-terminal region of human CAMK1G (CaMKI gamma). |
Rabbit Polyclonal Antibody against CAMK1G (Center K226)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CAMK1G antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 211-241 amino acids from the Central region of human CAMK1G. |
CAMK1G Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 217-476 of human CAMK1G (NP_065172.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
