Rabbit Polyclonal Anti-Dpysl5 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Dpysl5 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Dpysl5. Synthetic peptide located within the following region: LADTPTRPVTRHGGMRDLHESSFSLSGSQIDDHVPKRASARILAPPGGRS |
Anti-CRMP5 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 504-518 amino acids of Human Collapsin response mediator protein 5 |
Anti-CRMP5 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 504-518 amino acids of Human Collapsin response mediator protein 5 |
DPYSL5 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human DPYSL5 |
CRMP5/DPYSL5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 445-564 of human CRMP5/CRMP5/DPYSL5 (NP_064519.2). |
| Modifications | Unmodified |
CRMP5/DPYSL5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 445-564 of human CRMP5/CRMP5/DPYSL5 (NP_064519.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
